Scaffold kg300_3264576

Overview

Basic Information

• Taxon OID: 2124908010
• Scaffold ID: kg300_3264576
• Source Dataset Name: Keratinized_gingiva_contig300
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Los Alamos National Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 9684
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (22.22%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Riemerella → Riemerella anatipestifer (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Keratinized Gingiva → Keratinized Gingiva Microbial Communities From Saint Louis, Missouri, Usa

Source Dataset Sampling Location

• Location Name: St. Louis, MO
• Coordinates
  • Lat. (^o): 38.646
  • Long. (^o): -90.224

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071327	Metagenome	122	N

Sequences

Protein ID	Family	RBS	Sequence
kg300_00272320	F071327	N/A	MEDLFNSVYSTHKGISFSTVVVFGAFIFLILQVHLSYKGRISDVLRKTSFFSMILLYIQGILGVFLGIYSPEFSEASGFSSYFKLFEYGIIILTCAGMITYVYMFLKSNQILTLKVLIIALAAALLFEYAYPWRIIFG