Basic Information | |
---|---|
Taxon OID | 2124908010 Open in IMG/M |
Scaffold ID | kg300_3255450 Open in IMG/M |
Source Dataset Name | Keratinized_gingiva_contig300 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Los Alamos National Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1026 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Keratinized Gingiva → Keratinized Gingiva Microbial Communities From Saint Louis, Missouri, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | St. Louis, MO | |||||||
Coordinates | Lat. (o) | 38.646 | Long. (o) | -90.224 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F097490 | Metagenome | 104 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
kg300_01329300 | F097490 | AGAAG | MKIDENKKEVLVEIRNNTENNYYLLSPIVSIMTKHLQYIGGEMIEGQIHHKKLDSIVCSVCIWDDICKEEYYAMRDIVLLPKKSVKKIKYKYDNEEYIEIETVHIGFPYNGYYNEIGKKMQFMLKKKLDSSNIIKGYEFYNKDIETMTIKM |
⦗Top⦘ |