| Basic Information | |
|---|---|
| Taxon OID | 2124908010 Open in IMG/M |
| Scaffold ID | kg300_2254205 Open in IMG/M |
| Source Dataset Name | Keratinized_gingiva_contig300 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Los Alamos National Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2236 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Keratinized Gingiva → Keratinized Gingiva Microbial Communities From Saint Louis, Missouri, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | St. Louis, MO | |||||||
| Coordinates | Lat. (o) | 38.646 | Long. (o) | -90.224 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F089056 | Metagenome | 109 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| kg300_01145080 | F089056 | N/A | SKRKEADNTMVLEKNHAFFLWNNDSLGCKHERTIEMGEELYNTFKKSNKNDSILLKEYLGTPTRRFKDKEVIIFMYYINSCCDNGQLLEECDVSFISITFTNKNKILFGKGIQ |
| ⦗Top⦘ |