Basic Information | |
---|---|
Taxon OID | 2100351000 Open in IMG/M |
Scaffold ID | BMHBC_163353 Open in IMG/M |
Source Dataset Name | Microbial communities from bioreactor (seeded with anoxic lake sediment) at LBNL, California, USA - Biofuel metagenome 1 version 2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 603 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Bioreactor → Microbial Communities From Bioreactor (Seeded With Sewage Sludge) At Lbnl, California, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lawrence Berkeley National Laboratory, California, USA | |||||||
Coordinates | Lat. (o) | 37.8754404 | Long. (o) | -122.2477251 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F063258 | Metagenome / Metatranscriptome | 129 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
BMHBC_23875650 | F063258 | N/A | MARANRFRVAMSAFVLLGVLEWVTLSPETVRVINGPNGMPLLDVSVRGVALAVLALFALRSWNHYRREMLEELERSGQE |
⦗Top⦘ |