| Basic Information | |
|---|---|
| Taxon OID | 2088090024 Open in IMG/M |
| Scaffold ID | MXSH_contig02461 Open in IMG/M |
| Source Dataset Name | Sample MXSH |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Research Council of Canada |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5274 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (28.57%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium WCE2008 | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Stomach → Unclassified → Rumen → Rumen Microbial Communities Of Musk Oxen From Alaska |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Fairbanks, Alaska | |||||||
| Coordinates | Lat. (o) | 64.880776 | Long. (o) | -147.869984 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076635 | Metagenome / Metatranscriptome | 118 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| MXSH_01977330 | F076635 | AGG | MIKRGTKVRVIKMDDAGGGFGWQAKQLNGRIFTVRYMDATKQIHLEETGIALIPGGGSV |
| ⦗Top⦘ |