| Basic Information | |
|---|---|
| Taxon OID | 2088090023 Open in IMG/M |
| Scaffold ID | MXFH_Contig56201 Open in IMG/M |
| Source Dataset Name | Sample MXFH |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Research Council of Canada |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 863 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Midgut → Unclassified → Rumen → Rumen Microbial Communities Of Musk Oxen From Alaska |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Fairbanks, Alaska | |||||||
| Coordinates | Lat. (o) | 64.880776 | Long. (o) | -147.869984 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F067245 | Metagenome / Metatranscriptome | 126 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| MXFH_00551850 | F067245 | N/A | LHFNSVDWVRTGITFNKDIIKDQTDVNCPQFDIYCILEDLIQFYTLKSGWKNCFRNENHSLKNGDNVTITLKNGELRYAVNDEDLGGFIKVDLCDKKEMYLLVHTRNEKV |
| ⦗Top⦘ |