Basic Information | |
---|---|
Taxon OID | 2088090022 Open in IMG/M |
Scaffold ID | MXST_contig93023 Open in IMG/M |
Source Dataset Name | Sample MXST |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | National Research Council of Canada |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 521 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Midgut → Unclassified → Rumen → Rumen Microbial Communities Of Musk Oxen From Alaska |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Fairbanks, Alaska | |||||||
Coordinates | Lat. (o) | 64.880776 | Long. (o) | -147.869984 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006329 | Metagenome / Metatranscriptome | 376 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
MXST_00635360 | F006329 | AGGAGG | MILELHVADVVDDHKIKMDAMRLKIRKIRKYAIHTEAWYHYAVGSIVTFVAVMIAFLVALKCFT |
⦗Top⦘ |