NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2088090022

2088090022: Sample MXST



Overview

Basic Information
IMG/M Taxon OID2088090022 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063147 | Gp0051951 | Ga0011057
Sample NameSample MXST
Sequencing StatusPermanent Draft
Sequencing CenterNational Research Council of Canada
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size86700198
Sequencing Scaffolds3
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium WCE20081
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameRumen Microbial Communities Of Musk Oxen From Alaska
TypeHost-Associated
TaxonomyHost-Associated → Mammals → Digestive System → Midgut → Unclassified → Rumen → Rumen Microbial Communities Of Musk Oxen From Alaska

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal proximal gut

Location Information
LocationFairbanks, Alaska
CoordinatesLat. (o)64.880776Long. (o)-147.869984Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006329Metagenome / Metatranscriptome376Y
F023770Metagenome / Metatranscriptome208Y
F032501Metagenome / Metatranscriptome179Y
F076635Metagenome / Metatranscriptome118Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
MXST_contig01563All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium WCE20087528Open in IMG/M
MXST_contig107740Not Available511Open in IMG/M
MXST_contig93023Not Available521Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
MXST_contig01563MXST_02151200F076635MIKRGTKVRVIKMDDAGGGFGWQAKQLNGRIFTVRYMDATKQIHLEETGIALIPGVDQYEIVKENE
MXST_contig107740MXST_00734160F023770MAKVEFDPGIDSVHGILMGTDPFYIRRYPERGGGVMHIVQARPNRSGHVPSPAEAQARVTFGEIFGRQKHLDFQ
MXST_contig107740MXST_00734170F032501MANENQERDWVKVLLEVMLKILTLGFYHIEKNRKDK
MXST_contig93023MXST_00635360F006329MILELHVADVVDDHKIKMDAMRLKIRKIRKYAIHTEAWYHYAVGSIVTFVAVMIAFLVALKCFT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.