NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold MXFT_Contig35060

Scaffold MXFT_Contig35060


Overview

Basic Information
Taxon OID2088090021 Open in IMG/M
Scaffold IDMXFT_Contig35060 Open in IMG/M
Source Dataset NameSample MXFT-1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterNational Research Council of Canada
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)782
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Unclassified → Unclassified → Rumen → Rumen Microbial Communities Of Musk Oxen From Alaska

Source Dataset Sampling Location
Location NameFairbanks, Alaska
CoordinatesLat. (o)64.880776Long. (o)-147.869984Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037527Metagenome / Metatranscriptome167Y

Sequences

Protein IDFamilyRBSSequence
MXFT_01868530F037527N/AMKILIKQNDMVKNHMKDFFKFINLEGKAYTELIERREELKAKYNAENQRVTAKKEKLYATGDVTKFELGTNEKGIDRERLMHDKPYAFEHICQNDTANLQKIYNQLGYANKMNMRELKKIIKEYCVRYVDNLKKFDEEFYPSINDLIGTWSNMQNFVMSANMPKMPAPAK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.