Basic Information | |
---|---|
Taxon OID | 2088090005 Open in IMG/M |
Scaffold ID | LWSO_GLQAYWI02IU2PI Open in IMG/M |
Source Dataset Name | Sediment microbial communities from Lake Washington, Seattle, for Methane and Nitrogen Cycles, original sample replicate 1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 525 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment → Freshwater Sediment Microbial Communities From Lake Washington, Seattle, Usa, For Methane And Nitrogen Cycles |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lake Washington, Seattle | |||||||
Coordinates | Lat. (o) | 47.052 | Long. (o) | -122.267889 | Alt. (m) | Depth (m) | 62 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F053879 | Metagenome / Metatranscriptome | 140 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
LWSO_04183240 | F053879 | N/A | EMRFGADGKGEGRMAYMTQINFSKKTNTVELENYSSEAVRLNELRLEVRK |
⦗Top⦘ |