Basic Information | |
---|---|
Taxon OID | 2088090003 Open in IMG/M |
Scaffold ID | LJN_F7QKVOU01ALGFP Open in IMG/M |
Source Dataset Name | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Genomics Institute (BGI), Lifesequencing S.L. |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 513 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere → Quercus Rhizosphere Microbial Communities From Sierra Nevada National Park, Granada, Spain |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sierra Nevada National Park, Granada, Spain | |||||||
Coordinates | Lat. (o) | 36.96971 | Long. (o) | -3.46027 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F023752 | Metagenome / Metatranscriptome | 209 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
LJN_00168230 | F023752 | N/A | LFNLLILISVELGARSAVKLFFPNKEVSLARRAAWTYDELRKLTGHPFLQFQGIPSTTGNQVLGWYFSNLNSRQLEGVDSFKASTGNLSIFNNFGFIGRDFAYAKPPGVIRIAALGASTTADGYPAMLEEYLNARVAAQSNRFEVMNFGHGYWTSAHVLVNFVLNVIDFA |
⦗Top⦘ |