Scaffold CNA_F7QKVOU01CF6Y8

Overview

Basic Information

• Taxon OID: 2088090002
• Scaffold ID: CNA_F7QKVOU01CF6Y8
• Source Dataset Name: Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Genomics Institute (BGI), Lifesequencing S.L.
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 500
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere → Quercus Rhizosphere Microbial Communities From Sierra Nevada National Park, Granada, Spain

Source Dataset Sampling Location

• Location Name: Sierra Nevada National Park, Granada, Spain
• Coordinates
  • Lat. (^o): 36.96213
  • Long. (^o): -3.41928

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017218	Metagenome	242	Y

Sequences

Protein ID	Family	RBS	Sequence
CNA_00816070	F017218	AGG	MDTRDIAAILIGLQVGLVIGLLAVGTTLLAPFGVGLLGAAAGFGVRRARLELIRRALRSQLR