Basic Information | |
---|---|
Taxon OID | 2084038014 Open in IMG/M |
Scaffold ID | SPCE_NA_FSPRUNR02I4NKC Open in IMG/M |
Source Dataset Name | Soil microbial community from Hopland, California, USA, that is PCE polluted - No amended |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | GATC-Biotech AG, Konstanz, Germany |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 526 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Contaminated → Soil → Soil Microbial Community From Hopland, California, Usa, That Is Pce Polluted |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Hopland, California, USA | |||||||
Coordinates | Lat. (o) | 38.9727 | Long. (o) | -123.1145 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F042226 | Metagenome | 158 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
SPCE_NA_00044250 | F042226 | AGG | MRDLRAAERRIKGGVRTLLVSLVALSALLVLPAASAKDFHPGDLRVCNSTHCVAVVNREELPELGSFYYGVATPARVRRPKLRAPYYELRFRNGYVTGIVAKQRLDRFLSYGVNLNRFARGEWYAVPRQMSSELRRLTVGMRPLRLTRAALAKSR |
⦗Top⦘ |