| Basic Information | |
|---|---|
| Taxon OID | 2084038014 Open in IMG/M |
| Scaffold ID | SPCE_NA_FSPRUNR02I4NKC Open in IMG/M |
| Source Dataset Name | Soil microbial community from Hopland, California, USA, that is PCE polluted - No amended |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | GATC-Biotech AG, Konstanz, Germany |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 526 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Contaminated → Soil → Soil Microbial Community From Hopland, California, Usa, That Is Pce Polluted |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Hopland, California, USA | |||||||
| Coordinates | Lat. (o) | 38.9727 | Long. (o) | -123.1145 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F042226 | Metagenome | 158 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| SPCE_NA_00044250 | F042226 | AGG | MRDLRAAERRIKGGVRTLLVSLVALSALLVLPAASAKDFHPGDLRVCNSTHCVAVVNREELPELGSFYYGVATPARVRRPKLRAPYYELRFRNGYVTGIVAKQRLDRFLSYGVNLNRFARGEWYAVPRQMSSELRRLTVGMRPLRLTRAALAKSR |
| ⦗Top⦘ |