2084038014: Soil microbial community from Hopland, California, USA, that is PCE polluted - No amended

Overview

Basic Information

• IMG/M Taxon OID: 2084038014
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0046478 | Gp0051955 | Ga0010978
• Sample Name: Soil microbial community from Hopland, California, USA, that is PCE polluted - No amended
• Sequencing Status: Permanent Draft
• Sequencing Center: GATC-Biotech AG, Konstanz, Germany
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 3430175
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Soil Microbial Community From Hopland, California, Usa, That Is Pce Polluted
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Contaminated → Soil → Soil Microbial Community From Hopland, California, Usa, That Is Pce Polluted

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → land → contaminated soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: Hopland, California, USA
• Coordinates
  • Lat. (^o): 38.9727
  • Long. (^o): -123.1145
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042226	Metagenome	158	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
SPCE_NA_FSPRUNR02I4NKC	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	526

Sequences

Scaffold ID	Protein ID	Family	Sequence
SPCE_NA_FSPRUNR02I4NKC	SPCE_NA_00044250	F042226	MRDLRAAERRIKGGVRTLLVSLVALSALLVLPAASAKDFHPGDLRVCNSTHCVAVVNREELPELGSFYYGVATPARVRRPKLRAPYYELRFRNGYVTGIVAKQRLDRFLSYGVNLNRFARGEWYAVPRQMSSELRRLTVGMRPLRLTRAALAKSR