NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BRPC2_contig01971

Scaffold BRPC2_contig01971


Overview

Basic Information
Taxon OID2084038000 Open in IMG/M
Scaffold IDBRPC2_contig01971 Open in IMG/M
Source Dataset NameBovine rumen viral communities from University of Illinois Dairy Farm in Urbana, IL, Cow rumen 7664
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)988
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Bovine Rumen → Bovine Rumen Viral Communities From University Of Illinois Dairy Farm In Urbana, Il

Source Dataset Sampling Location
Location NameUniversity of Illinois Dairy Farm in Urbana, IL
CoordinatesLat. (o)40.0886Long. (o)-88.2202Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023997Metagenome / Metatranscriptome208Y

Sequences

Protein IDFamilyRBSSequence
BRPC2_03678620F023997AGGAMITLKNWYQQQPEVVYLFRQIIKGDEFMKKLVRSEMSKQQWDKMVDGYSGCEIYKVIIENHSGKLHSWVYFKEGE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.