Basic Information | |
---|---|
Taxon OID | 2081372001 Open in IMG/M |
Scaffold ID | OV011_2_1_1_newblercontig03292 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Deepwater Horizon Oil Spill, sample DHOS OV011 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 935 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Marine → Marine Microbial Communities From Deepwater Horizon Oil Spill |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Deepwater Horizon Oil Spill, Gulf of Mexico | |||||||
Coordinates | Lat. (o) | 28.672222 | Long. (o) | -88.4375 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F063768 | Metagenome / Metatranscriptome | 129 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
OV011_00212450 | F063768 | GAGG | MGDGRVSDPVTTAEGAGEFIVLAEFSTALSGLLAGWSTDGADPDTSATMASLAARLGEHAGWWMDRTPESVLLEGEQAAASGAGRLTDILALLDVPPSDRRSAVAPVLDRLVAYLGVLSERLSPVGDAPALRTIRLVLADLEDRPR |
⦗Top⦘ |