| Basic Information | |
|---|---|
| Taxon OID | 2081372001 Open in IMG/M |
| Scaffold ID | OV011_2_1_1_newblercontig03292 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Deepwater Horizon Oil Spill, sample DHOS OV011 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 935 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Marine → Marine Microbial Communities From Deepwater Horizon Oil Spill |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Deepwater Horizon Oil Spill, Gulf of Mexico | |||||||
| Coordinates | Lat. (o) | 28.672222 | Long. (o) | -88.4375 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F063768 | Metagenome / Metatranscriptome | 129 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| OV011_00212450 | F063768 | GAGG | MGDGRVSDPVTTAEGAGEFIVLAEFSTALSGLLAGWSTDGADPDTSATMASLAARLGEHAGWWMDRTPESVLLEGEQAAASGAGRLTDILALLDVPPSDRRSAVAPVLDRLVAYLGVLSERLSPVGDAPALRTIRLVLADLEDRPR |
| ⦗Top⦘ |