NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold OV011_2_1_1_newblercontig03292

Scaffold OV011_2_1_1_newblercontig03292


Overview

Basic Information
Taxon OID2081372001 Open in IMG/M
Scaffold IDOV011_2_1_1_newblercontig03292 Open in IMG/M
Source Dataset NameMarine microbial communities from Deepwater Horizon Oil Spill, sample DHOS OV011
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)935
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Marine → Marine Microbial Communities From Deepwater Horizon Oil Spill

Source Dataset Sampling Location
Location NameDeepwater Horizon Oil Spill, Gulf of Mexico
CoordinatesLat. (o)28.672222Long. (o)-88.4375Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F063768Metagenome / Metatranscriptome129N

Sequences

Protein IDFamilyRBSSequence
OV011_00212450F063768GAGGMGDGRVSDPVTTAEGAGEFIVLAEFSTALSGLLAGWSTDGADPDTSATMASLAARLGEHAGWWMDRTPESVLLEGEQAAASGAGRLTDILALLDVPPSDRRSAVAPVLDRLVAYLGVLSERLSPVGDAPALRTIRLVLADLEDRPR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.