2081372001: Marine microbial communities from Deepwater Horizon Oil Spill, sample DHOS OV011

Overview

Basic Information

• IMG/M Taxon OID: 2081372001
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0063184 | Gp0051829 | Ga0026224
• Sample Name: Marine microbial communities from Deepwater Horizon Oil Spill, sample DHOS OV011
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 23846686
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Microbial Communities From Deepwater Horizon Oil Spill
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Marine → Marine Microbial Communities From Deepwater Horizon Oil Spill

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Deepwater Horizon Oil Spill, Gulf of Mexico
• Coordinates
  • Lat. (^o): 28.672222
  • Long. (^o): -88.4375
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063768	Metagenome / Metatranscriptome	129	N
F080654	Metagenome / Metatranscriptome	115	N

Associated Scaffolds

Scaffold	Taxonomy	Length
OV011_2_1_1_newblercontig03292	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	935
OV011_2_1_1_newblercontig12446	Not Available	568

Sequences

Scaffold ID	Protein ID	Family	Sequence
OV011_2_1_1_newblercontig03292	OV011_00212450	F063768	MGDGRVSDPVTTAEGAGEFIVLAEFSTALSGLLAGWSTDGADPDTSATMASLAARLGEHAGWWMDRTPESVLLEGEQAAASGAGRLTDILALLDVPPSDRRSAVAPVLDRLVAYLGVLSERLSPVGDAPALRTIRLVLADLEDRPR
OV011_2_1_1_newblercontig12446	OV011_00104350	F080654	VVADVISEETAESEPVGKTDLEERQDLWNKIQKFNPEASAMDYYDNSEWDLEKMRSDLKVILEKERFGR