| Basic Information | |
|---|---|
| Taxon OID | 2077657009 Open in IMG/M |
| Scaffold ID | BRPC3_contig04596 Open in IMG/M |
| Source Dataset Name | Bovine rumen viral communities from University of Illinois Dairy Farm in Urbana, IL, Cow rumen 6993 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 715 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Foregut → Rumen → Bovine Rumen → Bovine Rumen Viral Communities From University Of Illinois Dairy Farm In Urbana, Il |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | University of Illinois Dairy Farm in Urbana, IL | |||||||
| Coordinates | Lat. (o) | 40.0886 | Long. (o) | -88.2202 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F039427 | Metagenome / Metatranscriptome | 163 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| BRPC3_00966700 | F039427 | AGG | MSKKVFALVSGIVGALQTAGVAIVTYTSPENATLINSAIVAAGAAIIEICNMFVKD |
| ⦗Top⦘ |