| Basic Information | |
|---|---|
| Taxon OID | 2077657008 Open in IMG/M |
| Scaffold ID | BRPC1_contig00636 Open in IMG/M |
| Source Dataset Name | Bovine rumen viral communities from University of Illinois Dairy Farm in Urbana, IL, Cow rumen 7887 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1189 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Foregut → Rumen → Bovine Rumen → Bovine Rumen Viral Communities From University Of Illinois Dairy Farm In Urbana, Il |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | University of Illinois Dairy Farm in Urbana, IL | |||||||
| Coordinates | Lat. (o) | 40.0886 | Long. (o) | -88.2202 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F066313 | Metagenome | 126 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| BRPC1_00158280 | F066313 | N/A | MKKKIKNWMGKNNMTFSAIAGETFTNAEVVYTHIGLVVFLIVLGLAGNY |
| ⦗Top⦘ |