| Basic Information | |
|---|---|
| Taxon OID | 2077657002 Open in IMG/M |
| Scaffold ID | ZODLETONE_B4_GLDH0LQ04H87K5 Open in IMG/M |
| Source Dataset Name | Sulfur spring sediment and crust microbial communities from Zodletone, Oklahoma, USA - B4 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Mogene LC |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 518 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Warm (34-42C) → Sediment → Sulfur Spring Sediment And Crust → Sulfur Spring Sediment And Crust Microbial Communities From Zodletone, Oklahoma, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Southwest Oklahoma | |||||||
| Coordinates | Lat. (o) | 35.100293 | Long. (o) | -98.749601 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F037503 | Metagenome / Metatranscriptome | 168 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| ZODLETONE_00951030 | F037503 | N/A | CSLVVSLAEVELLIRLEGFTAYQPLTNSEYCKIYTGVSPRVLRSVDKRERTQTIS |
| ⦗Top⦘ |