Scaffold RmDRAFT_ConsensusfromContig1229778

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold RmDRAFT_ConsensusfromContig1229778

Scaffold RmDRAFT_ConsensusfromContig1229778

Overview

Basic Information
Taxon OID	2075704000 Open in IMG/M
Scaffold ID	RmDRAFT_ConsensusfromContig1229778 Open in IMG/M
Source Dataset Name	Bovine rumen microbial communities from Vernon, TX, USA, Sample 511
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Texas A and M University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	639
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Bovine Rumen → Bovine Rumen Microbial Communities From Vernon, Tx, Usa

Source Dataset Sampling Location
Location Name	Vernon, Texas
Coordinates	Lat. (^o)	34.154	Long. (^o)	-99.264	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059440	Metagenome / Metatranscriptome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
RmDRAFT_09015000	F059440	N/A	MGKTRLEREAEFKAKIAELDEYVKKMNAKSNKTDEEVDEVISAMQLTNKYLRAIGASEEEMYDI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.