Scaffold RmDRAFT_ConsensusfromContig1122983

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold RmDRAFT_ConsensusfromContig1122983

Scaffold RmDRAFT_ConsensusfromContig1122983

Overview

Basic Information
Taxon OID	2075704000 Open in IMG/M
Scaffold ID	RmDRAFT_ConsensusfromContig1122983 Open in IMG/M
Source Dataset Name	Bovine rumen microbial communities from Vernon, TX, USA, Sample 511
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Texas A and M University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	820
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Bovine Rumen → Bovine Rumen Microbial Communities From Vernon, Tx, Usa

Source Dataset Sampling Location
Location Name	Vernon, Texas
Coordinates	Lat. (^o)	34.154	Long. (^o)	-99.264	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048702	Metagenome / Metatranscriptome	147	Y

Sequences

Protein ID	Family	RBS	Sequence
RmDRAFT_01201800	F048702	AGGAG	MDKRMNKKTGEELQQYLAWRRKGSSVPSKKGKGSYNRKDFKKGVA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.