Scaffold umicr_newContig958074

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold umicr_newContig958074

Scaffold umicr_newContig958074

Overview

Basic Information
Taxon OID	2070309017 Open in IMG/M
Scaffold ID	umicr_newContig958074 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from Orebro University Hospital, Sweden - Sample 270
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Maryland School of Medicine
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1176
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Orebro University Hospital, Sweden, Of Individuals With Crohns Disease

Source Dataset Sampling Location
Location Name	Orebro University Hospital, Sweden
Coordinates	Lat. (^o)	59.274717	Long. (^o)	15.230656	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047125	Metagenome / Metatranscriptome	150	N

Sequences

Protein ID	Family	RBS	Sequence
mc15a_11404530	F047125	N/A	MDVVLLLMVLGVMLSGFWAADALDHIRREILRQEGKRRGW

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.