2070309017: Human fecal microbial communities from Orebro University Hospital, Sweden - Sample 270

Overview

Basic Information

• IMG/M Taxon OID: 2070309017
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0045401 | Gp0051419 | Ga0011141
• Sample Name: Human fecal microbial communities from Orebro University Hospital, Sweden - Sample 270
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Maryland School of Medicine
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 107612854
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Fecal Microbial Communities From Orebro University Hospital, Sweden, Of Individuals With Crohns Disease
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Orebro University Hospital, Sweden, Of Individuals With Crohns Disease

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Location: Orebro University Hospital, Sweden
• Coordinates
  • Lat. (^o): 59.274717
  • Long. (^o): 15.230656
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047125	Metagenome / Metatranscriptome	150	N

Associated Scaffolds

Scaffold	Taxonomy	Length
umicr_newContig958074	Not Available	1176

Sequences

Scaffold ID	Protein ID	Family	Sequence
umicr_newContig958074	mc15a_11404530	F047125	MDVVLLLMVLGVMLSGFWAADALDHIRREILRQEGKRRGW