| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2070309017 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0045401 | Gp0051419 | Ga0011141 |
| Sample Name | Human fecal microbial communities from Orebro University Hospital, Sweden - Sample 270 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Maryland School of Medicine |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 107612854 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Orebro University Hospital, Sweden, Of Individuals With Crohns Disease |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Orebro University Hospital, Sweden, Of Individuals With Crohns Disease |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Orebro University Hospital, Sweden | |||||||
| Coordinates | Lat. (o) | 59.274717 | Long. (o) | 15.230656 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047125 | Metagenome / Metatranscriptome | 150 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| umicr_newContig958074 | Not Available | 1176 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| umicr_newContig958074 | mc15a_11404530 | F047125 | MDVVLLLMVLGVMLSGFWAADALDHIRREILRQEGKRRGW |
| ⦗Top⦘ |