| Basic Information | |
|---|---|
| Taxon OID | 2070309004 Open in IMG/M |
| Scaffold ID | prs_FIHLEPW02RE27K Open in IMG/M |
| Source Dataset Name | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 505 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost → Green-Waste Compost Microbial Community At University Of California, Davis, Usa, From Solid State Bioreactor |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Luquillo Rain Forest, Puerto Rico | |||||||
| Coordinates | Lat. (o) | 18.311389 | Long. (o) | -65.8375 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F075474 | Metagenome | 119 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| prs_05499380 | F075474 | N/A | ISGDVAKTLAEPALVEKFARNAYTVESSSAAELARFLEEDTEKWEAVIKTTGIKID |
| ⦗Top⦘ |