| Basic Information | |
|---|---|
| Taxon OID | 2067725004 Open in IMG/M |
| Scaffold ID | GPKC_F5V46DG01AZ7IO Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Great Prairies - Kansas Corn soil |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 510 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Kansas, USA | |||||||
| Coordinates | Lat. (o) | 39.211666 | Long. (o) | -96.594768 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F043159 | Metagenome / Metatranscriptome | 157 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GPKC_01055890 | F043159 | GGAGG | VDLHFTIIDADAHHLDGPAYKNYLPERYRARSGPYFPAFGWDIFLNGTTGRKPTNPQEYCKDLDVEKIGDAVA |
| ⦗Top⦘ |