NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F043159

Metagenome / Metatranscriptome Family F043159

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F043159
Family Type Metagenome / Metatranscriptome
Number of Sequences 157
Average Sequence Length 54 residues
Representative Sequence VEFTIIDADAHHLDGPAYKNYLPEKYRARSGPYFPSFGWDIFLNGTTGRKP
Number of Associated Samples 143
Number of Associated Scaffolds 157

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 96.18 %
% of genes near scaffold ends (potentially truncated) 98.73 %
% of genes from short scaffolds (< 2000 bps) 89.81 %
Associated GOLD sequencing projects 140
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.726 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(10.191 % of family members)
Environment Ontology (ENVO) Unclassified
(29.299 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(35.669 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 15.69%    Coil/Unstructured: 84.31%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 157 Family Scaffolds
PF00528BPD_transp_1 75.80
PF00890FAD_binding_2 1.27
PF00903Glyoxalase 1.27
PF07883Cupin_2 0.64
PF13380CoA_binding_2 0.64
PF02776TPP_enzyme_N 0.64
PF04909Amidohydro_2 0.64
PF00330Aconitase 0.64



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.73 %
UnclassifiedrootN/A1.27 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2067725004|GPKC_F5V46DG01AZ7IOAll Organisms → cellular organisms → Bacteria510Open in IMG/M
2088090014|GPIPI_17261164All Organisms → cellular organisms → Bacteria2436Open in IMG/M
2162886006|SwRhRL3b_contig_1883845All Organisms → cellular organisms → Bacteria1437Open in IMG/M
2170459005|F1BAP7Q02HMAU0All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300000550|F24TB_10408257All Organisms → cellular organisms → Bacteria2461Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10099275All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium718Open in IMG/M
3300000881|JGI10215J12807_1022985All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1741Open in IMG/M
3300000890|JGI11643J12802_10001902All Organisms → cellular organisms → Bacteria1421Open in IMG/M
3300002558|JGI25385J37094_10147644All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium634Open in IMG/M
3300003993|Ga0055468_10087448All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium860Open in IMG/M
3300003997|Ga0055466_10015146All Organisms → cellular organisms → Bacteria → Proteobacteria1577Open in IMG/M
3300004067|Ga0055485_10022981All Organisms → cellular organisms → Bacteria1230Open in IMG/M
3300004145|Ga0055489_10076037All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium941Open in IMG/M
3300004778|Ga0062383_10596144All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium560Open in IMG/M
3300005093|Ga0062594_102728525All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium547Open in IMG/M
3300005175|Ga0066673_10176467All Organisms → cellular organisms → Bacteria1205Open in IMG/M
3300005293|Ga0065715_10786370All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium615Open in IMG/M
3300005294|Ga0065705_10898840All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium576Open in IMG/M
3300005328|Ga0070676_10020626All Organisms → cellular organisms → Bacteria3682Open in IMG/M
3300005332|Ga0066388_101142305All Organisms → cellular organisms → Bacteria1324Open in IMG/M
3300005338|Ga0068868_101778611All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium582Open in IMG/M
3300005340|Ga0070689_100265113All Organisms → cellular organisms → Bacteria1421Open in IMG/M
3300005354|Ga0070675_101228657All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium690Open in IMG/M
3300005367|Ga0070667_102331342All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium504Open in IMG/M
3300005439|Ga0070711_101441471All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium600Open in IMG/M
3300005454|Ga0066687_10604019All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium652Open in IMG/M
3300005471|Ga0070698_101431414All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium642Open in IMG/M
3300005526|Ga0073909_10036570All Organisms → cellular organisms → Bacteria → Proteobacteria1715Open in IMG/M
3300005530|Ga0070679_101815423All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium558Open in IMG/M
3300005536|Ga0070697_100062244All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3045Open in IMG/M
3300005536|Ga0070697_100296566All Organisms → cellular organisms → Bacteria1389Open in IMG/M
3300005564|Ga0070664_101323278All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium680Open in IMG/M
3300005578|Ga0068854_100637740All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium913Open in IMG/M
3300005616|Ga0068852_102138284All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300005713|Ga0066905_100858363All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium791Open in IMG/M
3300005718|Ga0068866_11175577All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium553Open in IMG/M
3300005981|Ga0081538_10270331All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium636Open in IMG/M
3300006049|Ga0075417_10638880All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium543Open in IMG/M
3300006797|Ga0066659_10733058All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium811Open in IMG/M
3300006845|Ga0075421_100121800All Organisms → cellular organisms → Bacteria3273Open in IMG/M
3300006845|Ga0075421_102177763All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium586Open in IMG/M
3300006846|Ga0075430_100045864All Organisms → cellular organisms → Bacteria3691Open in IMG/M
3300006852|Ga0075433_11499199All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium582Open in IMG/M
3300006854|Ga0075425_102317519All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium597Open in IMG/M
3300006871|Ga0075434_100053066All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium4029Open in IMG/M
3300006876|Ga0079217_10004642All Organisms → cellular organisms → Bacteria4028Open in IMG/M
3300006876|Ga0079217_10511227All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium750Open in IMG/M
3300006894|Ga0079215_10849397All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium646Open in IMG/M
3300006904|Ga0075424_101387084All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium747Open in IMG/M
3300006918|Ga0079216_10043970All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1889Open in IMG/M
3300006954|Ga0079219_12016460All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium549Open in IMG/M
3300007076|Ga0075435_101183533All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium669Open in IMG/M
3300007255|Ga0099791_10100948All Organisms → cellular organisms → Bacteria1328Open in IMG/M
3300009078|Ga0105106_10325011All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1113Open in IMG/M
3300009092|Ga0105250_10446643All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium580Open in IMG/M
3300009094|Ga0111539_10334297All Organisms → cellular organisms → Bacteria → Proteobacteria1763Open in IMG/M
3300009094|Ga0111539_10774882All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1116Open in IMG/M
3300009147|Ga0114129_12733614All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium588Open in IMG/M
3300009148|Ga0105243_10128742All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium2145Open in IMG/M
3300009156|Ga0111538_10909231All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1114Open in IMG/M
3300009162|Ga0075423_11304683All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium776Open in IMG/M
3300009162|Ga0075423_11460457All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium733Open in IMG/M
3300009167|Ga0113563_13096913All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium563Open in IMG/M
3300009821|Ga0105064_1134281All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300010043|Ga0126380_10482524All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium946Open in IMG/M
3300010358|Ga0126370_10902875All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium798Open in IMG/M
3300010358|Ga0126370_12046004All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium561Open in IMG/M
3300010359|Ga0126376_12432730All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium571Open in IMG/M
3300010360|Ga0126372_13222699All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium507Open in IMG/M
3300010366|Ga0126379_10592598All Organisms → cellular organisms → Bacteria1193Open in IMG/M
3300010375|Ga0105239_10455034All Organisms → cellular organisms → Bacteria1452Open in IMG/M
3300010398|Ga0126383_12323169All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300010400|Ga0134122_10265922All Organisms → cellular organisms → Bacteria1456Open in IMG/M
3300011406|Ga0137454_1102409All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium506Open in IMG/M
3300011409|Ga0137323_1088993All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium683Open in IMG/M
3300011416|Ga0137422_1072299All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium829Open in IMG/M
3300012041|Ga0137430_1121326All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium745Open in IMG/M
3300012179|Ga0137334_1158791All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300012227|Ga0137449_1043592All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium914Open in IMG/M
3300012228|Ga0137459_1141628All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium705Open in IMG/M
3300012350|Ga0137372_10007052All Organisms → cellular organisms → Bacteria → Proteobacteria10872Open in IMG/M
3300012357|Ga0137384_11565795All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300012509|Ga0157334_1068414All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300012897|Ga0157285_10164907Not Available670Open in IMG/M
3300012957|Ga0164303_10301894All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462944Open in IMG/M
3300012971|Ga0126369_11537872All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium755Open in IMG/M
3300012976|Ga0134076_10057976All Organisms → cellular organisms → Bacteria → Proteobacteria1473Open in IMG/M
3300012989|Ga0164305_10432784All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1017Open in IMG/M
3300013306|Ga0163162_10036321All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium4910Open in IMG/M
3300014271|Ga0075326_1199562All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium600Open in IMG/M
3300014300|Ga0075321_1044433All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium771Open in IMG/M
3300014326|Ga0157380_12856987All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300015372|Ga0132256_102189086All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium658Open in IMG/M
3300015372|Ga0132256_102441119All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium625Open in IMG/M
3300015372|Ga0132256_103168552All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium553Open in IMG/M
3300015374|Ga0132255_100846760All Organisms → cellular organisms → Bacteria1365Open in IMG/M
3300017966|Ga0187776_10222978All Organisms → cellular organisms → Bacteria1195Open in IMG/M
3300017966|Ga0187776_10306966All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1034Open in IMG/M
3300018028|Ga0184608_10105321All Organisms → cellular organisms → Bacteria1182Open in IMG/M
3300018031|Ga0184634_10526661All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium525Open in IMG/M
3300018053|Ga0184626_10204502All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium836Open in IMG/M
3300018053|Ga0184626_10204504All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium836Open in IMG/M
3300018059|Ga0184615_10346945All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium822Open in IMG/M
3300018075|Ga0184632_10259369All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium758Open in IMG/M
3300018075|Ga0184632_10328545All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium659Open in IMG/M
3300018078|Ga0184612_10082886All Organisms → cellular organisms → Bacteria → Proteobacteria1675Open in IMG/M
3300018081|Ga0184625_10038923All Organisms → cellular organisms → Bacteria2356Open in IMG/M
3300018084|Ga0184629_10240034All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium945Open in IMG/M
3300018422|Ga0190265_11813668All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium718Open in IMG/M
3300018422|Ga0190265_12665154All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium597Open in IMG/M
3300018431|Ga0066655_10886081All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium610Open in IMG/M
3300018466|Ga0190268_11201313All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium629Open in IMG/M
3300019257|Ga0180115_1232879Not Available698Open in IMG/M
3300019362|Ga0173479_10725321All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300019878|Ga0193715_1029550All Organisms → cellular organisms → Bacteria1189Open in IMG/M
3300020198|Ga0194120_10450671All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium593Open in IMG/M
3300021081|Ga0210379_10386175All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium618Open in IMG/M
3300021090|Ga0210377_10075496All Organisms → cellular organisms → Bacteria2288Open in IMG/M
3300021411|Ga0193709_1064638All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium835Open in IMG/M
3300024241|Ga0233392_1024720All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium630Open in IMG/M
3300025925|Ga0207650_11749609All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300025926|Ga0207659_11170890All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium661Open in IMG/M
3300025934|Ga0207686_10944717All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium697Open in IMG/M
3300025938|Ga0207704_11413145All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium596Open in IMG/M
3300026066|Ga0208290_1040533All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium524Open in IMG/M
3300026111|Ga0208291_1078761All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium581Open in IMG/M
3300026142|Ga0207698_11590736All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium669Open in IMG/M
3300026314|Ga0209268_1059817All Organisms → cellular organisms → Bacteria1181Open in IMG/M
3300026323|Ga0209472_1149922All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium875Open in IMG/M
3300026548|Ga0209161_10517172All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium529Open in IMG/M
3300026550|Ga0209474_10114769All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1794Open in IMG/M
3300027490|Ga0209899_1002576All Organisms → cellular organisms → Bacteria4104Open in IMG/M
3300027513|Ga0208685_1050773All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium897Open in IMG/M
3300027650|Ga0256866_1215036All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium518Open in IMG/M
3300027682|Ga0209971_1071219All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium844Open in IMG/M
3300027787|Ga0209074_10050578All Organisms → cellular organisms → Bacteria1270Open in IMG/M
3300027815|Ga0209726_10455906All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium583Open in IMG/M
3300027909|Ga0209382_11838483All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium588Open in IMG/M
3300028592|Ga0247822_10271652All Organisms → cellular organisms → Bacteria1288Open in IMG/M
3300029636|Ga0222749_10838970All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium502Open in IMG/M
3300030619|Ga0268386_10213026All Organisms → cellular organisms → Bacteria1441Open in IMG/M
(restricted) 3300031248|Ga0255312_1117771All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium653Open in IMG/M
3300031562|Ga0310886_10130850All Organisms → cellular organisms → Bacteria1296Open in IMG/M
3300031562|Ga0310886_10508358All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium728Open in IMG/M
3300031720|Ga0307469_10076889All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium2241Open in IMG/M
3300031720|Ga0307469_10631762All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium962Open in IMG/M
3300031740|Ga0307468_101077517All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium714Open in IMG/M
3300031754|Ga0307475_10894374All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium701Open in IMG/M
3300031945|Ga0310913_11090549All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium558Open in IMG/M
3300031995|Ga0307409_100101852All Organisms → cellular organisms → Bacteria2384Open in IMG/M
3300032005|Ga0307411_12042910All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium535Open in IMG/M
3300032059|Ga0318533_11017018All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium608Open in IMG/M
3300032144|Ga0315910_11542904All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium518Open in IMG/M
3300032157|Ga0315912_10246806All Organisms → cellular organisms → Bacteria1403Open in IMG/M
3300032261|Ga0306920_102900949All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium650Open in IMG/M
3300032893|Ga0335069_11910701All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium628Open in IMG/M
3300034150|Ga0364933_020635All Organisms → cellular organisms → Bacteria → Proteobacteria1577Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.92%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment6.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.37%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil5.10%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.10%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.82%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.55%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.55%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.55%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.55%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.91%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.91%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.91%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.91%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.27%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.27%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.27%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.27%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.27%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.27%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.27%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.27%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.64%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.64%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.64%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.64%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.64%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.64%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.64%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.64%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.64%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.64%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.64%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.64%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.64%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.64%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.64%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.64%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.64%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.64%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.64%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.64%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.64%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2067725004Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
2162886006Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300002558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cmEnvironmentalOpen in IMG/M
3300003993Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2EnvironmentalOpen in IMG/M
3300003997Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1EnvironmentalOpen in IMG/M
3300004067Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004145Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009821Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011406Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2EnvironmentalOpen in IMG/M
3300011409Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT423_2EnvironmentalOpen in IMG/M
3300011416Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2EnvironmentalOpen in IMG/M
3300012041Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2EnvironmentalOpen in IMG/M
3300012179Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2EnvironmentalOpen in IMG/M
3300012227Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT436_2EnvironmentalOpen in IMG/M
3300012228Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2EnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012509Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014271Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2EnvironmentalOpen in IMG/M
3300014300Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300019257Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019878Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2EnvironmentalOpen in IMG/M
3300020198Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65mEnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300021411Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2EnvironmentalOpen in IMG/M
3300024241Subsurface microbial communities from Mancos shale, Colorado, United States - Mancos A_50_July_PBEnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026066Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026111Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026314Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027490Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027513Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes)EnvironmentalOpen in IMG/M
3300027650Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeqEnvironmentalOpen in IMG/M
3300027682Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031248 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
GPKC_010558902067725004SoilVDLHFTIIDADAHHLDGPAYKNYLPERYRARSGPYFPAFGWDIFLNGTTGRKPTNPQEYCKDLDVEKIGDAVA
GPIPI_028840302088090014SoilMDHNFTVIDADAHHLDEPAYKNYLPERFRARSGPYFPSFGWDIFLNGTTGRKPANPEEYCKDLDVEKIGD
SwRhRL3b_0549.000011902162886006Switchgrass RhizosphereLIVEFTIIDADAHHLDGPAYKNYLPEKYRARSGPYFPSFGWDIFLNGTTGRKPNNPGEYCKDLDVEKIG
E41_105378602170459005Grass SoilMDHNFTVIDADAHHLDEPAYKNYLPERFRARSGPYFPSFGWDIFLNGTTGRKPANPEEYCKDLDVE
F24TB_1040825713300000550SoilVDHKFTVIDADAHHLDGPAYKDYLPERFRARSGPYFPSFGWDIFLNGTTG
AF_2010_repII_A1DRAFT_1009927513300000597Forest SoilMKFTVIDADAHHLDGPAYKNYLPERFRARSGPYFPSFGWDIFLNGT
JGI10215J12807_102298513300000881SoilVDFTIIDADAHHLDGPAYKNYLPEKYRARSGPYFPSFG
JGI11643J12802_1000190223300000890SoilVDFTVIDADAHHLDGPAYKNYLPERFRIRSGPYFPAFGWDIFLNDTTGRK
JGI25385J37094_1014764413300002558Grasslands SoilVDHNFTVIDADAHHLDGPAYKDYLPERFRIRSGPYFPSFGWDIFLNGTTGRKPANPQEYCKDL
Ga0055468_1008744813300003993Natural And Restored WetlandsVEFTIIDADAHHLDGPAYKDYLPEKYRGRSGPYFPSFGWDIFLNGTTGRKPSNPGEYCKDLDVEKIG
Ga0055466_1001514623300003997Natural And Restored WetlandsVDFNIIDADAHHLDGPAYKQYLPEKYRARSGPYFPSFGWDI
Ga0055485_1002298113300004067Natural And Restored WetlandsVEFTIIDADAHHLDGAAYKQYLPEKFRARSGPYFPSFGWDIFLNDTTGRKPANPAEYC
Ga0055489_1007603713300004145Natural And Restored WetlandsLEFTIIDADAHHLDGSAYKDYLPKKYRARSGPYFPSFGWDIFLNGSTGRN
Ga0062383_1059614413300004778Wetland SedimentVEHNFTIIDADAHHLDGAAYKRYLPEKFRARSGPYFPSFGWDIF
Ga0062594_10272852523300005093SoilVDFTVIDADAHHLDGPAYKNYLPERFRKRSGPYFPAFGWDIF
Ga0066673_1017646713300005175SoilVDHNFTVIDADAHHLDGPAYKDYLPERFRIRSGPYFPSFGWDIFL
Ga0065715_1078637013300005293Miscanthus RhizosphereVHPNFTIIDADAHHLDGPAYKNYLPEQYRTRSGPYFPSFGWDI
Ga0065705_1089884013300005294Switchgrass RhizosphereVEFTIIDADAHHLDGPAYKTYLPERFRVRSGPYFPSFGWDIFLNGTTGRKP
Ga0070676_1002062613300005328Miscanthus RhizosphereVDLHFTIIDADAHHLDGPAYKNYLPERYRARSGPYFPAFGWDIFLNGTTGRKPTNPQEYC
Ga0066388_10114230513300005332Tropical Forest SoilLDHPFTIIDADAHHLDGPAYKEYLPEKYRSRSGPYFPSFGWDIFLNGTTGRNPTNAQEYCKDLDVEKISDA
Ga0068868_10177861123300005338Miscanthus RhizosphereVDLHFTIIDADAHHLDGPAYKNYLPEQYRARSGPYFPAFGWDIFLNGTTGRKPTNPQEYC
Ga0070689_10026511313300005340Switchgrass RhizosphereVDLHFTIIDADAHHLDGPAYKNYLPEQYRARSGPYFPAFGWDIFLNGTTGRKPT
Ga0070675_10122865713300005354Miscanthus RhizosphereVHPTFTIIDADAHHLDGPAYKNYLPEQYRARSGPYFPSFGWDIFLNGTTGRKPANPQEYCKDLDV
Ga0070667_10233134223300005367Switchgrass RhizosphereLNFEIIDADAHHLDGGAYKTYLAEKYRARSGPYFPSFGWDIFLNGTTGRN
Ga0070711_10144147113300005439Corn, Switchgrass And Miscanthus RhizosphereVDFIVIDADAHHLDGSAYKNYLPERYRARSGPYFPSFGWDIF
Ga0066687_1060401923300005454SoilVEFTIIDADAHHLDEPAYKNYLPEKYRARSGPYFPSFGWDIFLNGTT
Ga0070698_10143141423300005471Corn, Switchgrass And Miscanthus RhizosphereVEFTIIDADAHHLDGPAYKTYLPEKFRSRSGPYFPSFGWDIFLNGTTGRKPTNPDEYCKDLDVEKIGDAV
Ga0073909_1003657013300005526Surface SoilVEFTIIDADAHHLDGKAYKKYLPEKFRARSGPYFPSFGWDIFLNDTTGRKPSNPEEYCKDLDVEKI
Ga0070679_10181542323300005530Corn RhizosphereMDFTIIDADAHHLDGPAYQNYLPAKYRARSGPYFPSFGWDIFLNGTTGRKPN
Ga0070697_10006224413300005536Corn, Switchgrass And Miscanthus RhizosphereVDFVVIDADAHHLDGLAYKNYLPERYRARSGPYFPSFGWDIFLND
Ga0070697_10029656613300005536Corn, Switchgrass And Miscanthus RhizosphereVEFTIIDADAHHLDGPAYKNYLPEKYRARSGPYFPSFGWDIFLNDTTGRKPTNS
Ga0070664_10132327823300005564Corn RhizosphereVHPTFTIIDADAHHLDGPAYKNYLPEQYRARSGPYFPSFGWDIFLNGT
Ga0068854_10063774023300005578Corn RhizosphereVEFTIIDADAHHLDGPAYKNYLPEKYRARSGPYFPSFGWDIFLNDT
Ga0068852_10213828423300005616Corn RhizosphereVDLHFTIIDADAHHLDGPAYKNYLPEQYRARSGPYFPAFGWDIFLNGTTGRKPTNPQEY*
Ga0066905_10085836313300005713Tropical Forest SoilVNHSFTVIDADAHHLDGPAYKNYLPERFRSRSGPYFPSFGWDIFLNGTTGRKPANPEEYC
Ga0068866_1117557723300005718Miscanthus RhizosphereLNFEIIDADAHHLDGGAYKTYLAEKYRARSGPYFPSFGWDIFLNGTTGR
Ga0081538_1027033113300005981Tabebuia Heterophylla RhizosphereVNDSFTVIDADAHHLDGPAYKDYLPEQFRARSGPYFPSFGW
Ga0075417_1063888013300006049Populus RhizosphereVEFTIIDADAHHLDGAAYKKYLPEKFRARSGPYFPAF
Ga0066659_1073305813300006797SoilVEFTIIDADAHHLDEPAYKNYLPEKYRARSGPYFPSFGWDI
Ga0075421_10012180033300006845Populus RhizosphereMEFTVIDADAHHLDEPAYKNYLPERFRARSGPYFPSFGWDIFLNGTTGRK
Ga0075421_10217776313300006845Populus RhizosphereVEHKFTIIDADAHHLDGPAYKDYLPEKFRARSGPYFPSFGWDIFLNGTTGRKPANPGEYC
Ga0075430_10004586433300006846Populus RhizosphereVEFTIIDADAHHLDGAAYKKYLPEKFRARSGPYFPAFGWDIFLNDTTGRKPSNPEEYCKDLDVEK
Ga0075433_1149919913300006852Populus RhizosphereMKFTVIDADAHHLDEPAYKNYLPERFRARSGPYFPSFGWDIFLNG
Ga0075425_10231751913300006854Populus RhizosphereVDPQFAIIDADAHHLDGPAYKNYLPERYRARSGPYFPAFGWDIFLNGTTGRKPTNPQEYCKDLDVE
Ga0075434_10005306613300006871Populus RhizosphereVEFTIIDADAHHLDGPAYKTYLPEKFRSRSGPYFPSFGWDIFLN
Ga0079217_1000464233300006876Agricultural SoilMIIDADAHHLDGPAYKNYLPEKYRARSGPYFPSFGWDIFLNGTTGRKP
Ga0079217_1051122723300006876Agricultural SoilVEFTIIDADAHHLDGPAYKNYLPEKYRARSGPYFPSFGWDIFLNGTTGRKP
Ga0079215_1084939723300006894Agricultural SoilVDFIVIDADAHHLDGPAYKNYLPEKYRARSGPYFPSFGWDIFLNGTTGRKPENPDE
Ga0075424_10138708413300006904Populus RhizosphereVEFTIIDADAHHLDGAAYKKYLPEKFRARSGPYFPSFGWDIFLNDTTGRKPSNPE
Ga0079216_1004397013300006918Agricultural SoilMIIDADAHHLDGPAYKDYLPEKYRARSGPYFPSFGWDIFLNGTTGRKPTNPEEY
Ga0079219_1201646013300006954Agricultural SoilVDLHFTIIDADAHHLDGPAYKNYLPERYRARSGPYFPAFGWDIFLNGTTGRKPTNPQE
Ga0075435_10118353323300007076Populus RhizosphereVEFTIIDADAHHLDGAAYKKYLPEKFRVRSGPYFPSFGWDIFLNDTTGRKP
Ga0099791_1010094823300007255Vadose Zone SoilMDHNFTVIDADAHHLDEPAYKNYLPERFRARSGPYFPSFGWDIFLNGTTGRKPANPEEYCKDLDVEKI
Ga0105106_1032501123300009078Freshwater SedimentLTVEFTIIDADAHHLDGAAYKQYLPEKFRIRSGPYFPAFGWDIFLNDTTGRKPANPVE
Ga0105250_1044664313300009092Switchgrass RhizosphereVDLHFTIIDADAHHLDGPAYKNYLPERYRARSGPYFPAFGWDIFLNGTTGRKPTNPQEYCKDL
Ga0111539_1033429713300009094Populus RhizosphereMYPTFTIIDADAHHLDGPAYKNYLPERYRARSGPYFPAFGWDIFLNGTT
Ga0111539_1077488213300009094Populus RhizosphereVDFTVIDADAHHLDGPAYKNYLPERFRKRSGPYFPAFGWDIFLNDTTGRKPATAEEYCKDLDVESIGDAV
Ga0114129_1273361413300009147Populus RhizosphereVDPHFTIIDADAHHLDGPAYKNYLPEQYRVRSGPYFPSFGWDIFLNGTTGRKPANPQEYCKDLDVEKIGDA
Ga0105243_1012874233300009148Miscanthus RhizosphereVEFTIIDADAHHLDAAAYKKYLPEKFRARSGPYFPSFGWDIYLTDTTGRKRRNPEEYCKDLE
Ga0111538_1090923113300009156Populus RhizosphereVDLHFTIIDADAHHLDGPAYKNYLPERYRARSGPYFPAFGWDIFLNGTTGRKPTNPQEYCKDLDVEKIGDAVAY
Ga0075423_1130468313300009162Populus RhizosphereVDPQFAIIDADAHHLDGPAYKNYLPERYRARSGPYFPAFGWDIFLNGTTGRKPTNPQEYCKDL
Ga0075423_1146045713300009162Populus RhizosphereMYPTFTIIDADAHHLDGPAYKNYLPERYRARSGPYFPAFGWDIFLNGTTGRKPTNPQEYCKDLDVEMIGD
Ga0113563_1309691313300009167Freshwater WetlandsLTVEFTIIDADAHHLDGAVYKQYLPEKFRARSGPYFPSFGWDIFLNDTTGRKPAN
Ga0105064_113428113300009821Groundwater SandVECNFTVIDADAHHLDGPAYKNYLPERFRARSGPYFPSFGWDIFLNGTTGRKPSNPEDYCKDLDVEKIGD
Ga0126380_1048252413300010043Tropical Forest SoilMEFTVIDADAHHLDGPAYKNYLPERFRSRSGPYFPSFGWDIFLNGTTG
Ga0126370_1090287513300010358Tropical Forest SoilVNHSFTVIDADAHHLDGPAYKNYLPERFRARSGPYFPSFGWDIFLNGTTGRKPATPEEYCID
Ga0126370_1204600413300010358Tropical Forest SoilMEFTVIDADAHHLDGPAYKNYLPERFRARSGPYFPSFGWDI
Ga0126376_1243273013300010359Tropical Forest SoilVNHSFTVIDADAHHLDGPAYKNYLPERFRARSGPYFPSFGWDIFLNGTT
Ga0126372_1322269913300010360Tropical Forest SoilVNHSFTVIDADAHHLDGPAYKNYLPERFRARSGPYFPSFGWDIFLNGTTGRKPATPEEYCIDLDAENIGD
Ga0126379_1059259823300010366Tropical Forest SoilMKFTVIDADAHHLDGPAYKNYLPERFRARSGPYFPSFGWDIFLNGTTGRKPAN
Ga0105239_1045503413300010375Corn RhizosphereVHPTFTIIDADAHHLDGPAYKNYLPERYRARSGPYFPSF
Ga0126383_1232316913300010398Tropical Forest SoilMKFTVIDADAHHLDGPAYKNYLPERFRARSGPYFPYFGWDIFLNGTTGRKPANPEEYCIDLDAENIGDAV
Ga0134122_1026592213300010400Terrestrial SoilVEFTIIDADAHHLDGAAYKKYLPEKFRARSGPYFPAFGWDIFLNDTTGRKPT
Ga0137454_110240923300011406SoilLTVEFTIIDADAHHLDGAAYKQYLPEKFRIRSGPYFPSFGWDIFLNDTTGRKPA
Ga0137323_108899323300011409SoilVEDLTVEFTIIDADAHHLDGAAYKQYLPEKFRARSGPYFPSFGWDIFLNDTTGRKPANPAEYCKDLDVEKI
Ga0137422_107229923300011416SoilVEDLTVEFTIIDADAHHLDGAAYKQYLPEKFRIRSGPYFPSFGWDIFLNDTTGRKPANPAEYCQDLD
Ga0137430_112132623300012041SoilLEDLTVEFTIIDADAHHLDGAAYKQYLPEKFRARSGPYFPSFGWDIFLNDTTGRKPANPAEY
Ga0137334_115879113300012179SoilVEFTIVDADAHHLDDPAYKNYLPEKYRARSGPYFPSFGWDIFLNGSTGRKPANPDEYCKDLDVEKIG
Ga0137449_104359223300012227SoilLTVEFTIIDADAHHLDGAAYKQYLPEKFRARSGPYFPSFGWDIFLNDTTGRKPANPQEYCKDLDVEK
Ga0137459_114162813300012228SoilVEDLTVEFTIIDADAHHLDGAAYKQYLPEKFRARSGPYFPSFGWDIFLNDTTG
Ga0137372_1000705213300012350Vadose Zone SoilLIVEFTIIDADAHHLDGPAYKAYLPERFRVRSGPYFPSFGWDIFLNGT
Ga0137384_1156579513300012357Vadose Zone SoilVDHNFTVIDADAHHLDEPAYKNYLPERFRARSGPYFPSFGWDIFLNGTTGRKPANPEEYCKDLD
Ga0157334_106841413300012509SoilVHPTFTIIDADAHHLDGPAYKNYLPEQYRVRSGPYFPSFGWDIFLNGTTGRKPANPQEYCKDLD
Ga0157285_1016490723300012897SoilLTVEFTIIDADAHHLDGAAYKQYLPEKFRARSGPYFPSFGWDIFLNDSTGRKPNNP
Ga0164303_1030189413300012957SoilVHPNFTIIDADAHHLDGPAYKNYLPEQYRARSGPYFPSFGW
Ga0126369_1153787223300012971Tropical Forest SoilVNHSFTVIDADAHHLDGPAYKNYLPERFRARSGPYFPSFGWDIFLNGTTGRKPA
Ga0134076_1005797613300012976Grasslands SoilVDHNFTVIDADAHHLDGPAYKDYLPERFRIRSGPYFPSFGWDIFLNGTT
Ga0164305_1043278413300012989SoilMKFTVIDADAHHLDEPAYKNYLPERLRARSGPYFPSFGWDIF
Ga0163162_1003632143300013306Switchgrass RhizosphereVEFTIIDADAHHLDGAAYKKYLPEKFRARSGPYFPSFGWNIFLNDTTGRKPSNPEEYCKDLDVE
Ga0075326_119956213300014271Natural And Restored WetlandsVVHDFTIIDADAHHLDGPAYKSYLPEKYRARSGPYFPSFGWDIFLK
Ga0075321_104443323300014300Natural And Restored WetlandsLIVDFNIIDADAHHLDGPAYKQYLPEKYRARSGPYFPSFGWDIFLNNT
Ga0157380_1285698723300014326Switchgrass RhizosphereVEFTIIDADAHHLDGPAYKNYLPEKYRARSGPYFPSFGWDIFLNDTTGRKPTNPEEYCKDLDVEK
Ga0132256_10218908613300015372Arabidopsis RhizosphereVEFTIIDADAHHLDAAAYKKYLPEKFRARSGPYFPSFGWDIFLNDTTGRKPSNPEEYCKDLDVEKIADAVAY
Ga0132256_10244111913300015372Arabidopsis RhizosphereVDFTIIDADAHHLDGPAYKNYLPEKYRARSGPYFPSFGWDIFLN
Ga0132256_10316855213300015372Arabidopsis RhizosphereLNFEIIDADAHHLDGGAYKTYLAEKYRARSGPYFPSFGWDIFLNGTTGRNPTNAKDYCK
Ga0132255_10084676013300015374Arabidopsis RhizosphereVHPNFTIIDADAHHLDGPAYKNYLPEQYRARSGPYFPSFG
Ga0187776_1022297823300017966Tropical PeatlandVDHNFTIIDADAHHLDGPAYKDYLPEKFRARSGPYFPSFGWDIFLNGTTGRK
Ga0187776_1030696623300017966Tropical PeatlandVDFAVIDANAHRLDGPAYQNYLPERYRTRSGPYFPSFGWDIFLNGTTGRKPANPQEYCKDLESAARSRVKMPWL
Ga0184608_1010532113300018028Groundwater SedimentVDHNFTVIDADAHHLDGPAYKNYLPEKFRTRSGPYFPSFGWDIFLNGTTGRKPTN
Ga0184634_1052666123300018031Groundwater SedimentVDHKFTIIDADAHHLDGPAYKDYLPEKFRARSGPYFPSFGWDIFL
Ga0184626_1020450213300018053Groundwater SedimentVDHNFNVIDADAHHLDEPAYKNYLPERFRARSGPYFPSFGWDIFLNGTTGRK
Ga0184626_1020450413300018053Groundwater SedimentVDHHFTVIDADAHHLDEPAYKNYLPERFRARSGPYFPSFGWDIFLNGTTGRK
Ga0184615_1034694523300018059Groundwater SedimentVEFTIIDADAHHLDGSAYKDYLPEKFRARSGPYFPSFGWDIFLNG
Ga0184632_1025936913300018075Groundwater SedimentVDHNFTVIDADAHHLDEPAYKNYLPERFRARSGPYFPSFGWDIFLNGTTGRKPANPEEYCKDLDVEKI
Ga0184632_1032854523300018075Groundwater SedimentVDHNFNVIDADAHHLDEPAYKNYLPERFRARSGPYFPSFGWDIFLNGTTGRKPANPEE
Ga0184612_1008288623300018078Groundwater SedimentVDHHFTVIDADAHHLDEPAYKNYLPERFRARSGPYFPSFGWDIFLNG
Ga0184625_1003892313300018081Groundwater SedimentMEFTVIDADAHHLDEPAYKNYLPERFRARSGPYFPS
Ga0184629_1024003413300018084Groundwater SedimentVEFTIIDADAHHLDGAAYKQYLPEKFRIRSGPYFPSFGWDIFLNDTTGRKPANPAEYCQDLDV
Ga0190265_1181366813300018422SoilVELTIVDADAHHLDGPAYKNYLPERFRVRSGPYFP
Ga0190265_1266515423300018422SoilVAFTIIDADAHHLDGPAYKNYLPEKYRARSGPYFPSFGWDIFLNG
Ga0066655_1088608123300018431Grasslands SoilVDHNFTVIDADAHHLDGPAYKDYLPERFRIRSGPYFPSFGWDIFLNG
Ga0190268_1120131323300018466SoilVEFTIIDADAHHLDGAAYKQYLPEKFRIRSGPYFPSFGWDIFLNDTTGRKPGNPAEYCQDLDVEKIGD
Ga0180115_123287913300019257Groundwater SedimentVDHSFTVIDADAHHLDEPGYKQYLPEKFRARSGPYYPSFGWDIFLNGTT
Ga0173479_1072532123300019362SoilVHPTFTIIDADAHHLDGPAYKNYLPEQYRARSGPYFPSFGWDIFLNGTTGRKPANPQEYCKDLDVEKIGD
Ga0193715_102955023300019878SoilVEFTIIDADAHHLDGPAYKTYLPEKFRSRSGPYFPSFGWDIFLNGTTGRKPTNPDEY
Ga0194120_1045067113300020198Freshwater LakeVNHAFTIIDADAHHLDGGAYKTYLPEKFRARSGPYFPSFGWDIFLNG
Ga0210379_1038617513300021081Groundwater SedimentVEFTIIDADAHHLDGAAYKQYLPEKFRIRSGPYFPSFGWDIFLNDTTGRKPANPAEYCQDLDVEKIGDA
Ga0210377_1007549633300021090Groundwater SedimentVEFTIIDADAHHLDGPAYKNYLPEKYRARSGPYFPSFGWDIFLNGTTERKPTNPGEY
Ga0193709_106463823300021411SoilVEFTIIDADAHHLDGPAYKKYLPEKYRARSGPYFPSFGWDIFLNDTTG
Ga0233392_102472013300024241Deep Subsurface SedimentVDHNFTIIDADAHHLDGPAYKDYLPEKFRARSGPYFPSFGWDIFLNGTTGRKPANPEEYCKDLDVERIGDA
Ga0207650_1174960913300025925Switchgrass RhizosphereVEFTIIDADAHHLDGAAYKQYLPEKFRARSGPYFPSFGWDIFLNDSTGRKPNNPQEYCKDLDVEKIGDAV
Ga0207659_1117089013300025926Miscanthus RhizosphereVHPTFTIIDADAHHLDGPAYKNYLPEQYRARSGPYFPSFGWDI
Ga0207686_1094471723300025934Miscanthus RhizosphereVEFTIIDADAHHLDGAAYKKYLPEKFRARSGPYFP
Ga0207704_1141314523300025938Miscanthus RhizosphereVEFTIIDADAHHLDGAAYKKYLPEKFRARSGPYFPSFGWDIFLN
Ga0208290_104053323300026066Natural And Restored WetlandsVEFTIIDADAHHLDGPAYKDYLPEKYRSRSGPYFPSFGWDIFLNGTTGR
Ga0208291_107876123300026111Natural And Restored WetlandsVIDADAHHLDAPAYKSYLPERFRARSGPYFPSFGWDIFLNGT
Ga0207698_1159073613300026142Corn RhizosphereVDLHFTIIDADAHHLDGPAYKNYLPEQYRARSGPYFPAFGWDIFLNGTTGRKPTNPQEYCKDLDVEKIG
Ga0209268_105981723300026314SoilVDHNFTVIDADAHHLDGPAYKDYLPERFRIRSGPYF
Ga0209472_114992213300026323SoilVDHNFTVIDADAHHLDGPAYKDYLPERFRIRSGPYFPSFGWDIFLNGTTGRKPA
Ga0209161_1051717223300026548SoilVDHNFTVIDADAHHLDGPAYKDYLPERFRIRSGPYFPSFGWDIFLNGTTGRK
Ga0209474_1011476913300026550SoilVDHNFTVIDADAHHLDGPAYKDYLPERFRIRSGPYFPSFGWDIFLNGTTGRKPANPQEYCKDLDAEK
Ga0209899_100257613300027490Groundwater SandVECNFTVIDADAHHLDGPAYKNYLPERFRARSGPYFPSFGWDIFLNGTTGRKPANPDEYCKDLDVE
Ga0208685_105077313300027513SoilVEFTIIDADAHHLDGAAYKQYLPEKFRIRSGPYFPSF
Ga0256866_121503623300027650SoilVDFAIVDADAHHLDGPAYKSYLPEKYRARSGPYFPSFGWDIFLNGTTGRKPSNADEYCKD
Ga0209971_107121923300027682Arabidopsis Thaliana RhizosphereVEFTIIDADAHHLDGPAYKDYLPEKFRARSGPYFPSFGWDIFLNGTTGRKPTNPGE
Ga0209074_1005057813300027787Agricultural SoilVDLHFTIIDADAHHLDGPAYKNYLPERYRARSGPYFPAFGWDIFLNGTTGRKPTNPREYC
Ga0209726_1045590613300027815GroundwaterVEFTIIDADAHHLDGAAYKQYLPEKFRQRSGPYFPS
Ga0209382_1183848313300027909Populus RhizosphereVDFTIIDADAHHLDGPAYKNYLPEKYRARSGPYFPSFGWDIFLNGTTGRKPTNPEEYCKD
Ga0247822_1027165223300028592SoilVDFTVIDADAHHLDGPAYKNYLPERFRKRSGPYFPAFGWDIFLNDTTGRKPATPQE
Ga0222749_1083897013300029636SoilVEFIVIDADAHHLDGLAYKNYLPERYRARSGPYFPSF
Ga0268386_1021302623300030619SoilVEFNVIDADAHHLDGPAYKNYLPERFRARSGPYFPSFGWDIFLNG
(restricted) Ga0255312_111777123300031248Sandy SoilVDFTIIDADAHHLDGPAYKNYLPEKYRARSGPYFPS
Ga0310886_1013085013300031562SoilVDFTVIDADAHHLDGPAYKNYLPERFRKRSGPYFPAFG
Ga0310886_1050835823300031562SoilVHPTFTIIDADAHHLDGPAYKNYLPEQYRARSGPYCPSFGWDIFLNGTTGRKPTT
Ga0307469_1007688913300031720Hardwood Forest SoilMDHNFTVIDADAHHLDEPAYKNYLPERFRARSGPYFPSFGWDIFLNGTT
Ga0307469_1063176223300031720Hardwood Forest SoilVNHSFTVIDADAHHLDGPAYKDYLPERFRARSGPYFPS
Ga0307468_10107751723300031740Hardwood Forest SoilVDHKFTVIDADAHHLDGPAYKDYLPERFRARSGPYFPSL
Ga0307475_1089437413300031754Hardwood Forest SoilVDFIVIDADAHHLDGSAYKNYLPERYRARSGPYFPSFGWDIFLNDTTGRKPTNPAEYCKD
Ga0310913_1109054923300031945SoilVDPNFTIIDADAHHLDGPAYKEYLPGRYRARSGPYFPSFGWDIFLNGT
Ga0307409_10010185233300031995RhizosphereVDFTVIDADAHHLDGPAYKNYLPERFRKRSGPYFPAFGWDIFLNDTTGRKPATRQEYC
Ga0307411_1204291013300032005RhizosphereVDFTVIDADAHHLDGPAYKDYLPERFRIRSGPYFSS
Ga0318533_1101701813300032059SoilVDPNFTIIDADAHHLDGPAYKEYLPGRYRARSGPYFPSFGWDIFLNGTTGRKPTNPQEYCKDLDVEKIGDAVA
Ga0315910_1154290423300032144SoilLDHNFTIIDADAHHLDGPAYKNYLPEKYRSRSGPYFPTFGWDIFLNGTTGR
Ga0315912_1024680613300032157SoilVQFTIIDADAHHLDGAAYKQYLPEKFRARSGPYFPSFGWDIFLNDTTGRKPANPQEYC
Ga0306920_10290094923300032261SoilVNHNFTVIDADAHHLDEPAYKNYLPERLRARSGPYFPSFGWDIFLNGTTGRKP
Ga0335069_1191070123300032893SoilMEFTVIDADAHHLDGPAYKDYLPERYRARSGPYFPSFGWDIFLNGTTGRKPA
Ga0364933_020635_2_1903300034150SedimentVDHNFTVIDADAHHLDEPAYKNYLPERFRARSGPYFPSFGWDIFLNGTTGRKPANPEEYCKDL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.