Scaffold bke_il_soap_contig_39669

Overview

Basic Information

• Taxon OID: 2065487001
• Scaffold ID: bke_il_soap_contig_39669
• Source Dataset Name: Human fecal microbial communities from Baylor College of Medicine, Texas, USA, mock community - bke_il_soap
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Baylor College of Medicine
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2136
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (20.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Baylor College Of Medicine, Texas, Usa, Mock Community

Source Dataset Sampling Location

• Location Name: Baylor School of Medicine, Houston, Texas, USA
• Coordinates
  • Lat. (^o): 29.7
  • Long. (^o): -95.38

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074899	Metagenome / Metatranscriptome	119	N

Sequences

Protein ID	Family	RBS	Sequence
bke_il_soap_00698360	F074899	N/A	MSGRKQWNKQAVTSSFLDKKPPESLILQGLEGSTTLGKDEVGSSNLPSSSK