2065487001: Human fecal microbial communities from Baylor College of Medicine, Texas, USA, mock community - bke_il_soap

Overview

Basic Information

• IMG/M Taxon OID: 2065487001
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0046037 | Gp0051813 | Ga0011103
• Sample Name: Human fecal microbial communities from Baylor College of Medicine, Texas, USA, mock community - bke_il_soap
• Sequencing Status: Permanent Draft
• Sequencing Center: Baylor College of Medicine
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 132938616
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Fecal Microbial Communities From Baylor College Of Medicine, Texas, Usa, Mock Community
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Baylor College Of Medicine, Texas, Usa, Mock Community

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Location: Baylor School of Medicine, Houston, Texas, USA
• Coordinates
  • Lat. (^o): 29.7
  • Long. (^o): -95.38
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074899	Metagenome / Metatranscriptome	119	N

Associated Scaffolds

Scaffold	Taxonomy	Length
bke_il_soap_contig_39669	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae	2136

Sequences

Scaffold ID	Protein ID	Family	Sequence
bke_il_soap_contig_39669	bke_il_soap_00698360	F074899	MSGRKQWNKQAVTSSFLDKKPPESLILQGLEGSTTLGKDEVGSSNLPSSSK