Scaffold rumenHiSeq_NODE_4177190_len_112620_cov_0_653152

Overview

Basic Information

• Taxon OID: 2061766007
• Scaffold ID: rumenHiSeq_NODE_4177190_len_112620_cov_0_653152
• Source Dataset Name: Bovine rumen microbial communities fromthe University of Illinois at Urbana-Champaign, USA, that are switchgrass associated - Sample 470
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 112670
• Total Scaffold Genes: 165
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 110 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Bovine Rumen → Switchgrass-Associated Bovine Rumen Microbial Communities From Urbana, Illinois, Usa

Source Dataset Sampling Location

• Location Name: University of Illinois at Urbana - Champaign, Illinois, USA
• Coordinates
  • Lat. (^o): 40.096
  • Long. (^o): -88.2315

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072949	Metagenome / Metatranscriptome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
_HiSeq_27169550	F072949	AGG	MAKRKVTVNKVVVDKNAAQFMRTAANLARKGKTNKKLHGRHANPKALKYDMGV