| Basic Information | |
|---|---|
| Taxon OID | 2058419001 Open in IMG/M |
| Scaffold ID | GSLSAAI_contig13760 Open in IMG/M |
| Source Dataset Name | Saline water microbial communities from Great Salt Lake, Utah, sample from South Arm Antelope Island 1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1484 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Water Microbial Communities From Great Salt Lake, Utah |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Great Salt Lake, Utah | |||||||
| Coordinates | Lat. (o) | 41.454358 | Long. (o) | -112.666397 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005874 | Metagenome | 387 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GSLSAAI_01423990 | F005874 | GAG | MAKIPSRPPDDMLSPEELYNRVEETVNLSVDDLFAFKRSEYNEEYNARKSDQAQAKDEPLDDVIRLLSTPPEAWKDEDDGFNEVQEAEELLDFQRRTQAQIASQGLGMNFLGDDRDMTMREAASIRWGIDPDDDREWL |
| ⦗Top⦘ |