Scaffold GSLSAAI_contig05615

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GSLSAAI_contig05615

Scaffold GSLSAAI_contig05615

Overview

Basic Information
Taxon OID	2058419001 Open in IMG/M
Scaffold ID	GSLSAAI_contig05615 Open in IMG/M
Source Dataset Name	Saline water microbial communities from Great Salt Lake, Utah, sample from South Arm Antelope Island 1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1328
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (60.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Water Microbial Communities From Great Salt Lake, Utah

Source Dataset Sampling Location
Location Name	Great Salt Lake, Utah
Coordinates	Lat. (^o)	41.454358	Long. (^o)	-112.666397	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073153	Metagenome	120	N

Sequences

Protein ID	Family	RBS	Sequence
GSLSAAI_00423990	F073153	GGA	MSEQDLPVRDEIARIDGNIEGILTRLGQQGESVARLDLLVEEMKEMQAELEHIEVRLNTLEGRID

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.