Basic Information | |
---|---|
Taxon OID | 2058419001 Open in IMG/M |
Scaffold ID | GSLSAAI_contig05615 Open in IMG/M |
Source Dataset Name | Saline water microbial communities from Great Salt Lake, Utah, sample from South Arm Antelope Island 1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1328 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Water Microbial Communities From Great Salt Lake, Utah |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Great Salt Lake, Utah | |||||||
Coordinates | Lat. (o) | 41.454358 | Long. (o) | -112.666397 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F073153 | Metagenome | 120 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
GSLSAAI_00423990 | F073153 | GGA | MSEQDLPVRDEIARIDGNIEGILTRLGQQGESVARLDLLVEEMKEMQAELEHIEVRLNTLEGRID |
⦗Top⦘ |