Scaffold GSLNARP_contig00043

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GSLNARP_contig00043

Scaffold GSLNARP_contig00043

Overview

Basic Information
Taxon OID	2051774008 Open in IMG/M
Scaffold ID	GSLNARP_contig00043 Open in IMG/M
Source Dataset Name	Saline water microbial communities from Great Salt Lake, Utah, sample from North Arm Rozel Point
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	610
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Water Microbial Communities From Great Salt Lake, Utah

Source Dataset Sampling Location
Location Name	Great Salt Lake
Coordinates	Lat. (^o)	41.454358	Long. (^o)	-112.666397	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088354	Metagenome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
GSLNARP_01377800	F088354	GGAG	MTDTDTPRAQLDVDRFETATVNANGQIYLGRDLQGVKVHVAIEIVTDDD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.