Scaffold mhc6b_MHC6B_contig02440

Overview

Basic Information

• Taxon OID: 2051223007
• Scaffold ID: mhc6b_MHC6B_contig02440
• Source Dataset Name: Human fecal microbial communities from Orebro University Hospital, Sweden - Sample 10375
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Maryland School of Medicine
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2028
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Orebro University Hospital, Sweden, Of Individuals With Crohns Disease

Source Dataset Sampling Location

• Location Name: Orebro University Hospital, Sweden
• Coordinates
  • Lat. (^o): 59.274717
  • Long. (^o): 15.230656

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076064	Metagenome	118	N

Sequences

Protein ID	Family	RBS	Sequence
MHC6B_contig02440_metagene_gene_4	F076064	N/A	LKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLSRLFSARRQIRLCAPDLKRRNETRRHPMPVLKLY