Basic Information | |
---|---|
Taxon OID | 2051223007 Open in IMG/M |
Scaffold ID | mhc6b_MHC6B_contig01984 Open in IMG/M |
Source Dataset Name | Human fecal microbial communities from Orebro University Hospital, Sweden - Sample 10375 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Maryland School of Medicine |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 10568 |
Total Scaffold Genes | 14 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 11 (78.57%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Orebro University Hospital, Sweden, Of Individuals With Crohns Disease |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Orebro University Hospital, Sweden | |||||||
Coordinates | Lat. (o) | 59.274717 | Long. (o) | 15.230656 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F092228 | Metagenome | 107 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
MHC6B_contig01984_metagene_gene_5 | F092228 | GAGG | MKKKCTLVLISVLTVACIVSAYLLFFYNPSFNMVYDSDTDSYFNNSYLSYNDGTLAAADYRKTKVTAYDSKNNSTVKLPSNGCLINDNLFYINGNKLCCLDTTTNTRKIIDTDCRSFVCNNEVIAYTKNDSVILKDSDTLENIGDIKFDNQIYYINISDGNLYIAERIFEDKTDEYGYSFKVGKQYIFKKYDLKSCKLLKSKNANYVNGIRYVTVCKDTFYFFCDETQTVNNVCLDKDVNYPTIQHPDVKFITSNNDCVYYISEKTESAIIRKTVESPYNGIWKLEVGSNKPAKIAGKCDCDELLATKNFLYCYTINYILPRGLANSWVKGYLIDQLAIS |
⦗Top⦘ |