| Basic Information | |
|---|---|
| Taxon OID | 2049941003 Open in IMG/M |
| Scaffold ID | GB_4MN_4MetaGsffNew_c12863 Open in IMG/M |
| Source Dataset Name | Hydrothermal vent microbial communities from Guaymas and Carmen Basins, Gulf of California, Sample 420 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Pennsylvania State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1874 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (28.57%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Hydrothermal Vent Microbial Communities From Guaymas And Carmen Basins, Gulf Of California |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Gulf of California | |||||||
| Coordinates | Lat. (o) | 27.823 | Long. (o) | -111.4 | Alt. (m) | Depth (m) | 1996 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004643 | Metagenome / Metatranscriptome | 429 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GB_4MN_00782480 | F004643 | N/A | LNDLAKYYDKEFWEENGWVSCFECDIIFEDLEKLYEHQDLHLEEEKK |
| ⦗Top⦘ |