Scaffold 900MB_Assembly_NODE_994481_len_163906_cov_12_139556

Overview

Basic Information

• Taxon OID: 2049941000
• Scaffold ID: 900MB_Assembly_NODE_994481_len_163906_cov_12_139556
• Source Dataset Name: Bovine rumen microbial communities fromthe University of Illinois at Urbana-Champaign, USA, that are switchgrass associated - 900 MB Assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 163956
• Total Scaffold Genes: 161
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 64 (39.75%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Bovine Rumen → Switchgrass-Associated Bovine Rumen Microbial Communities From Urbana, Illinois, Usa

Source Dataset Sampling Location

• Location Name: University of Illinois at Urbana - Champaign, Illinois, USA
• Coordinates
  • Lat. (^o): 40.096
  • Long. (^o): -88.2315

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076635	Metagenome / Metatranscriptome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
_900MB_Assembly_8651610	F076635	GGA	VKMDTAGGMDWQAKRLEGKVFTVRFIDSAGQIHLEETGIALLPGVDEYEIVK