Basic Information | |
---|---|
IMG/M Taxon OID | 2049941000 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0059810 | Gp0051627 | Ga0011138 |
Sample Name | Bovine rumen microbial communities fromthe University of Illinois at Urbana-Champaign, USA, that are switchgrass associated - 900 MB Assembly |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 925521509 |
Sequencing Scaffolds | 14 |
Novel Protein Genes | 15 |
Associated Families | 8 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 5 |
All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. | 2 |
All Organisms → cellular organisms → Bacteria | 2 |
Not Available | 4 |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Switchgrass-Associated Bovine Rumen Microbial Communities From Urbana, Illinois, Usa |
Type | Host-Associated |
Taxonomy | Host-Associated → Mammals → Digestive System → Foregut → Rumen → Bovine Rumen → Switchgrass-Associated Bovine Rumen Microbial Communities From Urbana, Illinois, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | University of Illinois at Urbana - Champaign, Illinois, USA | |||||||
Coordinates | Lat. (o) | 40.096 | Long. (o) | -88.2315 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F015685 | Metagenome / Metatranscriptome | 252 | Y |
F032501 | Metagenome / Metatranscriptome | 179 | Y |
F036964 | Metagenome / Metatranscriptome | 169 | Y |
F074260 | Metagenome / Metatranscriptome | 119 | Y |
F076635 | Metagenome / Metatranscriptome | 118 | Y |
F076729 | Metagenome / Metatranscriptome | 117 | Y |
F087968 | Metagenome / Metatranscriptome | 110 | Y |
F098367 | Metagenome / Metatranscriptome | 103 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
900MB_Assembly_NODE_1028372_len_182402_cov_8_373181 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 182452 | Open in IMG/M |
900MB_Assembly_NODE_1041937_len_84497_cov_4_569890 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. | 84547 | Open in IMG/M |
900MB_Assembly_NODE_159263_len_34017_cov_16_693712 | All Organisms → cellular organisms → Bacteria | 34067 | Open in IMG/M |
900MB_Assembly_NODE_281337_len_159957_cov_14_314947 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 160007 | Open in IMG/M |
900MB_Assembly_NODE_295814_len_14416_cov_3_474750 | Not Available | 14466 | Open in IMG/M |
900MB_Assembly_NODE_475410_len_5229_cov_1_071333 | Not Available | 5279 | Open in IMG/M |
900MB_Assembly_NODE_490094_len_16428_cov_27_263514 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 16478 | Open in IMG/M |
900MB_Assembly_NODE_522796_len_4981_cov_0_468179 | Not Available | 5031 | Open in IMG/M |
900MB_Assembly_NODE_664657_len_97568_cov_15_004192 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 97618 | Open in IMG/M |
900MB_Assembly_NODE_784033_len_183413_cov_12_034637 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 183463 | Open in IMG/M |
900MB_Assembly_NODE_871879_len_16183_cov_1_247544 | Not Available | 16233 | Open in IMG/M |
900MB_Assembly_NODE_879001_len_36171_cov_0_516049 | All Organisms → cellular organisms → Bacteria | 36221 | Open in IMG/M |
900MB_Assembly_NODE_969782_len_63717_cov_5_215625 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. | 63767 | Open in IMG/M |
900MB_Assembly_NODE_994481_len_163906_cov_12_139556 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 163956 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
900MB_Assembly_NODE_1028372_len_182402_cov_8_373181 | _900MB_Assembly_7363390 | F076635 | MIKRGSRVRVVKMDTAGGMDWQAKRLEGKVFTVRFIDSAGMIHLEETGIALIPGVDQFEVVK |
900MB_Assembly_NODE_1041937_len_84497_cov_4_569890 | _900MB_Assembly_4394380 | F076729 | MNLTDNEVLKFLKGGPVFLEDICAVYSVTLGEIVDIGYDKF |
900MB_Assembly_NODE_159263_len_34017_cov_16_693712 | _900MB_Assembly_10330230 | F076635 | MIKRGAKVRVIKIDDAGGMDWQARQLNGKIFTVRYVDSTGQIHLEETGIALIPGVDQFEVVK |
900MB_Assembly_NODE_281337_len_159957_cov_14_314947 | _900MB_Assembly_2258850 | F015685 | MFARVRGKFNRSETLYFKGCPCKKEQLGVDLLNPSKANGAKHILSQNALKTAVQAAKTALADPTERATLEAGFQAQKKYTSLFAYTVAQKYVKPSYGE |
900MB_Assembly_NODE_295814_len_14416_cov_3_474750 | _900MB_Assembly_10965630 | F032501 | MKTESEEKDWVKVLYEVILKILTLGFYHVEKHRKS |
900MB_Assembly_NODE_475410_len_5229_cov_1_071333 | _900MB_Assembly_4756080 | F032501 | MKQETENESKDWVKVLCEVILKILTLGFYHLEKHKNR |
900MB_Assembly_NODE_490094_len_16428_cov_27_263514 | _900MB_Assembly_9051670 | F076635 | MIKRGTKVRVIKRDDAGGGFGWHAKQLNGRIFTVRYMDATKQIHLEETGIALIPGVDQYEIVKENE |
900MB_Assembly_NODE_522796_len_4981_cov_0_468179 | _900MB_Assembly_9446870 | F087968 | MKVTKTYARTLYNAGKAVMIIPNKMRTDSFMAVWQTKPDDDPYADFDKLVNAISYYNCSPETGMGLCYYAKEA |
900MB_Assembly_NODE_664657_len_97568_cov_15_004192 | _900MB_Assembly_9307320 | F076635 | MIKRGSKVRVVKMDTAGGMDWQAKRLEGKVFTVRYIDSAGMIHLEETGIALLPGVDEFEILK |
900MB_Assembly_NODE_784033_len_183413_cov_12_034637 | _900MB_Assembly_5866780 | F076635 | MIKRGSRVRVVKMDTAGGMDWQAKRLEGKVFTVHFIDSAGQIHLEETGIALIPGVDEYEVIR |
900MB_Assembly_NODE_871879_len_16183_cov_1_247544 | _900MB_Assembly_4447070 | F036964 | MNVLKMLFPGLMVLGALGSLIVNIIERGDGAVSLQWIGACLLYTALLLRNMS |
900MB_Assembly_NODE_879001_len_36171_cov_0_516049 | _900MB_Assembly_7358090 | F032501 | MKTENEEKDWVKVLYEVILKILTLGFYHVEKHRKDK |
900MB_Assembly_NODE_969782_len_63717_cov_5_215625 | _900MB_Assembly_1012230 | F098367 | MSDDTFRRLRNYHVRLGTVINELEILEDFTDADYTDIITDIGYCTNLLEQRRERLQRRGRSL |
900MB_Assembly_NODE_969782_len_63717_cov_5_215625 | _900MB_Assembly_1012650 | F074260 | MAEKKKQTTKKTAKKPELLPFDELPIQVKRNRRLLYEYIRTGNLPE |
900MB_Assembly_NODE_994481_len_163906_cov_12_139556 | _900MB_Assembly_8651610 | F076635 | VKMDTAGGMDWQAKRLEGKVFTVRFIDSAGQIHLEETGIALLPGVDEYEIVK |
⦗Top⦘ |