Scaffold 900MB_Assembly_NODE_1041937_len_84497_cov_4_569890

Overview

Basic Information

• Taxon OID: 2049941000
• Scaffold ID: 900MB_Assembly_NODE_1041937_len_84497_cov_4_569890
• Source Dataset Name: Bovine rumen microbial communities fromthe University of Illinois at Urbana-Champaign, USA, that are switchgrass associated - 900 MB Assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 84547
• Total Scaffold Genes: 128
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 84 (65.62%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Bovine Rumen → Switchgrass-Associated Bovine Rumen Microbial Communities From Urbana, Illinois, Usa

Source Dataset Sampling Location

• Location Name: University of Illinois at Urbana - Champaign, Illinois, USA
• Coordinates
  • Lat. (^o): 40.096
  • Long. (^o): -88.2315

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076729	Metagenome / Metatranscriptome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
_900MB_Assembly_4394380	F076729	N/A	MNLTDNEVLKFLKGGPVFLEDICAVYSVTLGEIVDIGYDKF