Basic Information | |
---|---|
Taxon OID | 2044078009 Open in IMG/M |
Scaffold ID | mobDRAFT_NODE_3426_len_1315_cov_9_505703 Open in IMG/M |
Source Dataset Name | Sample 10347 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1349 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human Oral → Human Oral Microbial Communities From J. Craig Venter Institute, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F095632 | Metagenome | 105 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
mobDRAFT_677420 | F095632 | AGGA | MSFKETTGYKVVSLVASTSASITAGAVVGALCPPAGVVLTAIYGVGSSVLGTYVGDKAGRQYAETLAETIDSMKTPQTN |
⦗Top⦘ |