Scaffold 2044924125

Overview

Basic Information

• Taxon OID: 2044078008
• Scaffold ID: 2044924125
• Source Dataset Name: Mixed alcohol bioreactor microbial communities from Texas A and M University - 55C, Day 16
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 10216
• Total Scaffold Genes: 21
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 17 (80.95%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Mixed Alcohol Bioreactor → Mixed Alcohol Bioreactor Microbial Communities From Texas A&M University

Source Dataset Sampling Location

• Location Name: Texas A and M University College Station, Texas, USA
• Coordinates
  • Lat. (^o): 30.620833
  • Long. (^o): -96.341111

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088752	Metagenome / Metatranscriptome	109	N

Sequences

Protein ID	Family	RBS	Sequence
2044972271	F088752	AGGA	MKGLQSVYDQIINILKENNVLINITPPRPYLIKKDDEERINAEAEDLFKKCKIEEYNSKMKEKEAYKLYFDEAYKYTNFYEEGDE