| Basic Information | |
|---|---|
| Taxon OID | 2044078003 Open in IMG/M |
| Scaffold ID | MGB_F548DK201DGRI5 Open in IMG/M |
| Source Dataset Name | Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Illinois, Urbana-Champaign |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 531 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Switchgrass, Maize And Miscanthus Rhizosphere → Switchgrass, Maize And Miscanthus Rhizosphere Microbial Communities From University Of Illinois Energy Farm, Urbana, Il |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | UIUC Energy Farm, Urbana, Illinois 61801 | |||||||
| Coordinates | Lat. (o) | 40.109 | Long. (o) | -88.204 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F042086 | Metagenome / Metatranscriptome | 159 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| MGB_165070 | F042086 | N/A | MKSKQIENIVVDEFRQQTYVVMAHRILTDGELYSAIRVEILKRKGVLTKGERLVITSELS |
| ⦗Top⦘ |