NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold sed3_GCH9ZVC01D936Y

Scaffold sed3_GCH9ZVC01D936Y


Overview

Basic Information
Taxon OID2043231005 Open in IMG/M
Scaffold IDsed3_GCH9ZVC01D936Y Open in IMG/M
Source Dataset NameSediment 3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSoedertoern University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)544
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine → Marine Microbial Communities From The Landsort Deep, Baltic Sea

Source Dataset Sampling Location
Location NameSweden
CoordinatesLat. (o)58.58333333Long. (o)18.23333333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005937Metagenome / Metatranscriptome386Y
F010314Metagenome / Metatranscriptome305Y

Sequences

Protein IDFamilyRBSSequence
sed3_440510F005937AGGMVMVKADVSISVTQIITIAAMFASILGSYYSLSAKIETNTAEVAKLKYNEKEYTWKAQRQLEAEVRTITLEMRDFMKDLEYLKIDKKKR
sed3_440520F010314N/AMENLKIYLLNGTALAISVSEINPILQTVSLLLAIGYTVIQISKKLK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.