Basic Information | |
---|---|
Taxon OID | 2043231005 Open in IMG/M |
Scaffold ID | sed3_GCH9ZVC01BX6X6 Open in IMG/M |
Source Dataset Name | Sediment 3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Soedertoern University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 501 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Falkowbacteria → Candidatus Falkowbacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine → Marine Microbial Communities From The Landsort Deep, Baltic Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sweden | |||||||
Coordinates | Lat. (o) | 58.58333333 | Long. (o) | 18.23333333 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F041161 | Metagenome / Metatranscriptome | 160 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
sed3_323420 | F041161 | N/A | MYTLQMMGKQVAESVQFADQFLPRATTPKEIWFILKDNLVYKNDPPGIELLQSFPSLMNDNYWGIPGAGDCDCFTIAALACAAVRGIPARAVIVGNSSQAPTHVYCQYLVDGRWIDFD |
⦗Top⦘ |