NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold sed3_GCH9ZVC01BX6X6

Scaffold sed3_GCH9ZVC01BX6X6


Overview

Basic Information
Taxon OID2043231005 Open in IMG/M
Scaffold IDsed3_GCH9ZVC01BX6X6 Open in IMG/M
Source Dataset NameSediment 3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSoedertoern University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)501
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Falkowbacteria → Candidatus Falkowbacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine → Marine Microbial Communities From The Landsort Deep, Baltic Sea

Source Dataset Sampling Location
Location NameSweden
CoordinatesLat. (o)58.58333333Long. (o)18.23333333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041161Metagenome / Metatranscriptome160N

Sequences

Protein IDFamilyRBSSequence
sed3_323420F041161N/AMYTLQMMGKQVAESVQFADQFLPRATTPKEIWFILKDNLVYKNDPPGIELLQSFPSLMNDNYWGIPGAGDCDCFTIAALACAAVRGIPARAVIVGNSSQAPTHVYCQYLVDGRWIDFD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.