| Basic Information | |
|---|---|
| Taxon OID | 2043231004 Open in IMG/M |
| Scaffold ID | sed2_GCH9ZVC02GCSM9 Open in IMG/M |
| Source Dataset Name | Sediment 2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Soedertoern University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 502 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Sediment → Marine → Marine Microbial Communities From The Landsort Deep, Baltic Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sweden | |||||||
| Coordinates | Lat. (o) | 58.58333333 | Long. (o) | 18.23333333 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F040946 | Metagenome / Metatranscriptome | 161 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| sed2_1756850 | F040946 | GGA | MYPKLKIESDNHETIEIETLPVDFMMYEELQGIKPASEQGMRLTIAYYYLEDKEPGNLATVKLWARRNRVKVEMVSESAEPFTEGATAG |
| ⦗Top⦘ |