NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold sed2_GCH9ZVC01AS1MF

Scaffold sed2_GCH9ZVC01AS1MF


Overview

Basic Information
Taxon OID2043231004 Open in IMG/M
Scaffold IDsed2_GCH9ZVC01AS1MF Open in IMG/M
Source Dataset NameSediment 2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSoedertoern University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)502
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine → Marine Microbial Communities From The Landsort Deep, Baltic Sea

Source Dataset Sampling Location
Location NameSweden
CoordinatesLat. (o)58.58333333Long. (o)18.23333333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082572Metagenome / Metatranscriptome113Y

Sequences

Protein IDFamilyRBSSequence
sed2_1537380F082572N/ASQLVSICPSTQEHNTASAAVTNANNIGEDIVVLTLSMSCDTFWDYETELHVDRKQFSRKYTNRPEEEAFQTLSQFMCLHMKKHIEDELINDGKRNMLAKLEEVFPKFHIHGQTSHEILYPNDPSNSDHCRGDGKIFICTHC
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.