Scaffold Landsort10m_GCH9ZVC02H6UFR

Overview

Basic Information

• Taxon OID: 2043231002
• Scaffold ID: Landsort10m_GCH9ZVC02H6UFR
• Source Dataset Name: 10 m water depth
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Soedertoern University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 502
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Landsort Deep, Baltic Sea

Source Dataset Sampling Location

• Location Name: Sweden
• Coordinates
  • Lat. (^o): 58.58333333
  • Long. (^o): 18.23333333
  • Depth (m): 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003495	Metagenome / Metatranscriptome	483	Y

Sequences

Protein ID	Family	RBS	Sequence
10m_1587050	F003495	N/A	MKENNEKKMKNEDEISKLIKAFPKDIAALDKRSVLAKVNSQGSGT