Basic Information | |
---|---|
Taxon OID | 2043231002 Open in IMG/M |
Scaffold ID | Landsort10m_GCH9ZVC02H6MOV Open in IMG/M |
Source Dataset Name | 10 m water depth |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Soedertoern University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 514 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Landsort Deep, Baltic Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sweden | |||||||
Coordinates | Lat. (o) | 58.58333333 | Long. (o) | 18.23333333 | Alt. (m) | Depth (m) | 10 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F028500 | Metagenome / Metatranscriptome | 191 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
10m_829000 | F028500 | GGA | MMYEIRTKWTNLIVYRTTERANAVYWLEENNQEGVFKLVRVK |
⦗Top⦘ |