| Basic Information | |
|---|---|
| Taxon OID | 2040502003 Open in IMG/M |
| Scaffold ID | LanddsortDeep80_GCH9ZVC01B2T7X Open in IMG/M |
| Source Dataset Name | 80 m water depth |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Soedertoern University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 531 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Landsort Deep, Baltic Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sweden | |||||||
| Coordinates | Lat. (o) | 58.58333333 | Long. (o) | 18.23333333 | Alt. (m) | Depth (m) | 80 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F071404 | Metagenome | 122 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| 80m_1238650 | F071404 | N/A | MFSPFFTNKKKIIKQLLDMIEYLIADNNRLRQKIERIEHRQGLRFGGT |
| ⦗Top⦘ |