NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Coalbed1143_GAIGPUK01ECNIV

Scaffold Coalbed1143_GAIGPUK01ECNIV


Overview

Basic Information
Taxon OID2038011002 Open in IMG/M
Scaffold IDCoalbed1143_GAIGPUK01ECNIV Open in IMG/M
Source Dataset NameCoalbed microbial communities from New Mexico, USA - 343
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterVirginia Polytechnic Institute and State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)556
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water → Coalbed Water Microbial Communities From New Mexico, Usa

Source Dataset Sampling Location
Location NameNew Mexico
CoordinatesLat. (o)36.728056Long. (o)-108.220833Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F060097Metagenome133Y

Sequences

Protein IDFamilyRBSSequence
Coalbed5_11283660F060097GGAMTEVIRVDLEKRDPGKSIALLDEKSDQRGGHSPILVEPGGIVQLRYQGRRVGARITKAAANEFVGQILSFENGKPKLEDLTQNDFIAFQEENIFGYDPPAKI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.